Tryptophan Hydroxylase (TPH1) (NM_004179) Human Mass Spec Standard

CAT#: PH321254

TPH1 MS Standard C13 and N15-labeled recombinant protein (NP_004170)

Product Images

Coomassie blue staining of purified TPH1 protein (Cat# TP321254). The protein was produced from HEK293T cells transfected with TPH1 cDNA clone (Cat# RC221254) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221254
• Predicted MW: 50.8 kDa
• Protein Sequence:
  Sequence Link

  >RC221254 representing NM_004179
  Red=Cloning site Green=Tags(s)
  
  MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINR
  EQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNV
  YRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDN
  IPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPL
  LAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAK
  VKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA
  MNELQHDLDVVSDALAKVSRKPSI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004170
• RefSeq Size: 1335
• RefSeq ORF: 1332
• Synonyms: TPRH; TRPH
• Locus ID: 7166
• UniProt ID: P17752
• Cytogenetics: 11p15.1
• Summary: 'This gene encodes a member of the aromatic amino acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene have been associated with an elevated risk for a variety of diseases and disorders, including schizophrenia, somatic anxiety, anger-related traits, bipolar disorder, suicidal behavior, addictions, and others.[provided by RefSeq, Apr 2009]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Tryptophan metabolism