CXorf40A (NM_178124) Human Mass Spec Standard

CAT#: PH321372

CXorf40A MS Standard C13 and N15-labeled recombinant protein (NP_835225)

Product Images

Coomassie blue staining of purified CXorf40A protein (Cat# TP321372). The protein was produced from HEK293T cells transfected with CXorf40A cDNA clone (Cat# RC221372) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221372
• Predicted MW: 17.9 kDa
• Protein Sequence:
  Sequence Link

  >RC221372 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQA
  LLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGK
  DVFQVDIPEHLIPLGHEV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_835225
• RefSeq Size: 2436
• RefSeq ORF: 474
• Synonyms: CXorf40; EOLA1
• Locus ID: 91966
• UniProt ID: Q8TE69
• Cytogenetics: Xq28
• Summary: May have an important role of cell protection in inflammation reaction. [UniProtKB/Swiss-Prot Function]