SRP9 (NM_003133) Human Mass Spec Standard

CAT#: PH321573

SRP9 MS Standard C13 and N15-labeled recombinant protein (NP_003124)

Product Images

Coomassie blue staining of purified SRP9 protein (Cat# TP321573). The protein was produced from HEK293T cells transfected with SRP9 cDNA clone (Cat# RC221573) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221573
• Predicted MW: 10.1 kDa
• Protein Sequence:
  Sequence Link

  >RC221573 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLM
  RLMVAKEARNVTMETE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003124
• RefSeq Size: 1524
• RefSeq ORF: 258
• Synonyms: ALURBP
• Locus ID: 6726
• UniProt ID: P49458
• Cytogenetics: 1q42.12
• Summary: ''
• Protein Families: Druggable Genome
• Protein Pathways: Protein export