SRP9 (NM_003133) Human Mass Spec Standard
CAT#: PH321573
SRP9 MS Standard C13 and N15-labeled recombinant protein (NP_003124)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221573 |
Predicted MW | 10.1 kDa |
Protein Sequence |
>RC221573 protein sequence
Red=Cloning site Green=Tags(s) MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLM RLMVAKEARNVTMETE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003124 |
RefSeq Size | 1524 |
RefSeq ORF | 258 |
Synonyms | ALURBP |
Locus ID | 6726 |
UniProt ID | P49458 |
Cytogenetics | 1q42.12 |
Summary | '' |
Protein Families | Druggable Genome |
Protein Pathways | Protein export |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418876 | SRP9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418876 | Transient overexpression lysate of signal recognition particle 9kDa (SRP9), transcript variant 2 |
USD 396.00 |
|
TP321573 | Recombinant protein of human signal recognition particle 9kDa (SRP9), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review