Caspase-7 (CASP7) (NM_033338) Human Mass Spec Standard

CAT#: PH321589

CASP7 MS Standard C13 and N15-labeled recombinant protein (NP_203124)

Product Images

Coomassie blue staining of purified CASP7 protein (Cat# TP321589). The protein was produced from HEK293T cells transfected with CASP7 cDNA clone (Cat# RC221589) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221589
• Predicted MW: 37.6 kDa
• Protein Sequence:
  Sequence Link

  >RC221589 representing NM_033338
  Red=Cloning site Green=Tags(s)
  
  MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQMADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFS
  KKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFD
  VIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEK
  PKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCS
  ILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_203124
• RefSeq Size: 2712
• RefSeq ORF: 1008
• Synonyms: CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3
• Locus ID: 840
• UniProt ID: P55210
• Cytogenetics: 10q25.3
• Summary: 'This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]'
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Alzheimer's disease, Apoptosis