VMO1 (NM_182566) Human Mass Spec Standard
CAT#: PH321753
VMO1 MS Standard C13 and N15-labeled recombinant protein (NP_872372)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221753 |
Predicted MW | 21.5 kDa |
Protein Sequence |
>RC221753 protein sequence
Red=Cloning site Green=Tags(s) MERGAGAKLLPLLLLLRATGFTCAQTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQ GIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAAN NVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_872372 |
RefSeq Size | 785 |
RefSeq ORF | 606 |
Synonyms | ERGA6350; PRO21055 |
Locus ID | 284013 |
UniProt ID | Q7Z5L0 |
Cytogenetics | 17p13.2 |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405488 | VMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405488 | Transient overexpression lysate of vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 1 |
USD 396.00 |
|
TP321753 | Purified recombinant protein of Homo sapiens vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 1 |
USD 399.00 |
|
TP720495 | Recombinant protein of human vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 3 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review