VMO1 (NM_182566) Human Mass Spec Standard

CAT#: PH321753

VMO1 MS Standard C13 and N15-labeled recombinant protein (NP_872372)

Product Images

Coomassie blue staining of purified VMO1 protein (Cat# TP321753). The protein was produced from HEK293T cells transfected with VMO1 cDNA clone (Cat# RC221753) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221753
• Predicted MW: 21.5 kDa
• Protein Sequence:
  Sequence Link

  >RC221753 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERGAGAKLLPLLLLLRATGFTCAQTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQ
  GIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAAN
  NVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_872372
• RefSeq Size: 785
• RefSeq ORF: 606
• Synonyms: ERGA6350; PRO21055
• Locus ID: 284013
• UniProt ID: Q7Z5L0
• Cytogenetics: 17p13.2
• Protein Families: Secreted Protein