CORO1B (NM_001018070) Human Mass Spec Standard

CAT#: PH322047

CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_001018080)

Product Images

Coomassie blue staining of purified CORO1B protein (Cat# TP322047). The protein was produced from HEK293T cells transfected with CORO1B cDNA clone (Cat# RC222047) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222047
• Predicted MW: 54.2 kDa
• Protein Sequence:
  Sequence Link

  >RC222047 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGR
  IDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAW
  HPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTL
  VAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTS
  VVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM
  TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA
  PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001018080
• RefSeq Size: 1949
• RefSeq ORF: 1467
• Synonyms: CORONIN-2
• Locus ID: 57175
• UniProt ID: Q9BR76, A0A024R5K1
• Cytogenetics: 11q13.2
• Summary: Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 [PubMed 16027158]). [supplied by OMIM, Mar 2008]