CAMK2D (NM_172128) Human Mass Spec Standard
CAT#: PH322121
CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742126)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222121 |
Predicted MW | 54.1 kDa |
Protein Sequence |
>RC222121 protein sequence
Red=Cloning site Green=Tags(s) MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKH PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPE NLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVG YPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVAS MMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEI IKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_742126 |
RefSeq Size | 5776 |
RefSeq ORF | 1434 |
Synonyms | CAMKD |
Locus ID | 817 |
UniProt ID | Q13557 |
Cytogenetics | 4q26 |
Summary | 'The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Distinct isoforms of this chain have different expression patterns.[provided by RefSeq, Nov 2008]' |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406847 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406848 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406849 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430341 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430342 | CAMK2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406847 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 4 |
USD 325.00 |
|
LY406848 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1 |
USD 325.00 |
|
LY406849 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 2 |
USD 325.00 |
|
LY430341 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1 |
USD 325.00 |
|
LY430342 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 5 |
USD 325.00 |
|
PH307454 | CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742125) |
USD 2,055.00 |
|
PH318801 | CAMK2D MS Standard C13 and N15-labeled recombinant protein (NP_742113) |
USD 2,055.00 |
|
TP307454 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 1 |
USD 823.00 |
|
TP318801 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 4 |
USD 748.00 |
|
TP322121 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II delta (CAMK2D), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review