SLC25A3 (NM_005888) Human Mass Spec Standard
CAT#: PH322824
SLC25A3 MS Standard C13 and N15-labeled recombinant protein (NP_005879)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222824 |
Predicted MW | 40.09 kDa |
Protein Sequence |
>RC222824 representing NM_005888
Red=Cloning site Green=Tags(s) MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGL GGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGF YEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKE EGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIV SHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005879 |
RefSeq Size | 1688 |
RefSeq ORF | 1086 |
Synonyms | OK/SW-cl.48; PHC; PTP |
Locus ID | 5250 |
UniProt ID | Q00325, A0A024RBH9, Q6MZF9 |
Cytogenetics | 12q23.1 |
Summary | The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403888 | SLC25A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417005 | SLC25A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419206 | SLC25A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403888 | Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
LY417005 | Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 396.00 |
|
LY419206 | Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 396.00 |
|
TP322824 | Recombinant protein of human solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review