WTAP (NM_152857) Human Mass Spec Standard
CAT#: PH323046
WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223046 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC223046 representing NM_152857
Red=Cloning site Green=Tags(s) MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN ELSAWKFTPDR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_690596 |
RefSeq Size | 1644 |
RefSeq ORF | 453 |
Synonyms | Mum2 |
Locus ID | 9589 |
UniProt ID | Q15007 |
Cytogenetics | 6q25.3 |
Summary | The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407186 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407187 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417661 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430230 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407186 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 |
USD 396.00 |
|
LY407187 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
USD 396.00 |
|
LY417661 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 1 |
USD 396.00 |
|
LY430230 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
USD 396.00 |
|
PH309632 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897) |
USD 2,055.00 |
|
PH323099 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690597) |
USD 2,055.00 |
|
TP309632 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 1 |
USD 823.00 |
|
TP323046 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 2 |
USD 748.00 |
|
TP323099 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review