MLX (NM_198205) Human Mass Spec Standard

CAT#: PH323064

MLX MS Standard C13 and N15-labeled recombinant protein (NP_937848)

Product Images

Coomassie blue staining of purified MLX protein (Cat# TP323064). The protein was produced from HEK293T cells transfected with MLX cDNA clone (Cat# RC223064) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223064
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC223064 representing NM_198205
  Red=Cloning site Green=Tags(s)
  
  MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQT
  IVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQD
  NPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLK
  NQLY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_937848
• RefSeq Size: 2316
• RefSeq ORF: 642
• Synonyms: bHLHd13; MAD7; MXD7; TCFL4; TF4
• Locus ID: 6945
• UniProt ID: Q9UH92
• Cytogenetics: 17q21.2
• Summary: 'The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transcription Factors