SCN3B (NM_001040151) Human Mass Spec Standard

CAT#: PH323114

SCN3B MS Standard C13 and N15-labeled recombinant protein (NP_001035241)

Product Images

Coomassie blue staining of purified SCN3B protein (Cat# TP323114). The protein was produced from HEK293T cells transfected with SCN3B cDNA clone (Cat# RC223114) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223114
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC223114 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGK
  DFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRL
  IPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEEAAQENASDYLAIPSENKENSA
  VPVEE
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035241
• RefSeq Size: 5682
• RefSeq ORF: 645
• Synonyms: ATFB16; BRGDA7; HSA243396; SCNB3
• Locus ID: 55800
• UniProt ID: Q9NY72, A0A024R3H7
• Cytogenetics: 11q24.1
• Summary: Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel beta subunit gene family, and influences the inactivation kinetics of the sodium channel. Two alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Sodium, Transmembrane