HOMER2 (NM_199330) Human Mass Spec Standard

CAT#: PH323154

HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955362)

Product Images

Coomassie blue staining of purified HOMER2 protein (Cat# TP323154). The protein was produced from HEK293T cells transfected with HOMER2 cDNA clone (Cat# RC223154) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223154
• Predicted MW: 40.4 kDa
• Protein Sequence:
  Sequence Link

  >RC223154 representing NM_199330
  Red=Cloning site Green=Tags(s)
  
  MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT
  SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ
  ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQ
  WKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQL
  MSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKL
  GTDN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_955362
• RefSeq Size: 2005
• RefSeq ORF: 1062
• Synonyms: ACPD; CPD; DFNA68; HOMER-2; VESL-2
• Locus ID: 9455
• UniProt ID: Q9NSB8
• Cytogenetics: 15q25.2
• Summary: This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. [provided by RefSeq, Jun 2011]
• Protein Families: Druggable Genome