Orosomucoid 2 (ORM2) (NM_000608) Human Mass Spec Standard

CAT#: PH323213

ORM2 MS Standard C13 and N15-labeled recombinant protein (NP_000599)

Product Images

Coomassie blue staining of purified ORM2 protein (Cat# TP323213). The protein was produced from HEK293T cells transfected with ORM2 cDNA clone (Cat# RC223213) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223213
• Predicted MW: 23.6 kDa
• Protein Sequence:
  Sequence Link

  >RC223213 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT
  PNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNW
  GLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000599
• RefSeq Size: 844
• RefSeq ORF: 603
• Synonyms: AGP-B; AGP-B'; AGP2
• Locus ID: 5005
• UniProt ID: P19652
• Cytogenetics: 9q32
• Summary: 'This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. [provided by RefSeq, Jul 2008]'
• Protein Families: Secreted Protein