UPB1 (NM_016327) Human Mass Spec Standard

CAT#: PH323365

UPB1 MS Standard C13 and N15-labeled recombinant protein (NP_057411)

Product Images

Coomassie blue staining of purified UPB1 protein (Cat# TP323365). The protein was produced from HEK293T cells transfected with UPB1 cDNA clone (Cat# RC223365) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223365
• Predicted MW: 43.2 kDa
• Protein Sequence:
  Sequence Link

  >RC223365 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQLRRPR
  IVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTREKLPWTEFAE
  SAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTRKNHIPRVGDFNESTY
  YMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANH
  CFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDGLLVAKLDLNLCQQV
  NDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057411
• RefSeq Size: 2167
• RefSeq ORF: 1152
• Synonyms: BUP1
• Locus ID: 51733
• UniProt ID: Q9UBR1, A0A024R1H3, B3KNC1
• Cytogenetics: 22q11.23
• Summary: This gene encodes a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity. [provided by RefSeq, Jul 2008]
• Protein Pathways: beta-Alanine metabolism, Drug metabolism - other enzymes, Metabolic pathways, Pantothenate and CoA biosynthesis, Pyrimidine metabolism