LYG2 (NM_175735) Human Mass Spec Standard

CAT#: PH323549

LYG2 MS Standard C13 and N15-labeled recombinant protein (NP_783862)

Product Images

Coomassie blue staining of purified LYG2 protein (Cat# TP323549). The protein was produced from HEK293T cells transfected with LYG2 cDNA clone (Cat# RC223549) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223549
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC223549 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFA
  EMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWD
  SKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQ
  SF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_783862
• RefSeq Size: 880
• RefSeq ORF: 636
• Synonyms: LYGH; LYSG2
• Locus ID: 254773
• UniProt ID: Q86SG7
• Cytogenetics: 2q11.2
• Summary: The protein encoded by this gene contains a SLT domain, a protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL). SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc). [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein