Casein (CSN1S1) (NM_001890) Human Mass Spec Standard
CAT#: PH323721
CSN1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001881)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223721 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC223721 protein sequence
Red=Cloning site Green=Tags(s) MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNE STQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLN QLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001881 |
RefSeq Size | 981 |
RefSeq ORF | 555 |
Synonyms | CASA; CSN1 |
Locus ID | 1446 |
UniProt ID | P47710 |
Cytogenetics | 4q13.3 |
Summary | '' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419687 | CSN1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422589 | CSN1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419687 | Transient overexpression lysate of casein alpha s1 (CSN1S1), transcript variant 1 |
USD 396.00 |
|
LY422589 | Transient overexpression lysate of casein alpha s1 (CSN1S1), transcript variant 2 |
USD 396.00 |
|
TP323721 | Recombinant protein of human casein alpha s1 (CSN1S1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review