OCM2 (NM_006188) Human Mass Spec Standard

CAT#: PH324075

OCM2 MS Standard C13 and N15-labeled recombinant protein (NP_006179)

Product Images

Coomassie blue staining of purified OCM2 protein (Cat# TP324075). The protein was produced from HEK293T cells transfected with OCM2 cDNA clone (Cat# RC224075) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224075
• Predicted MW: 12.2 kDa
• Protein Sequence:
  Sequence Link

  >RC224075 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQK
  FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006179
• RefSeq Size: 588
• RefSeq ORF: 327
• Synonyms: OCM; OM
• Locus ID: 4951
• UniProt ID: P0CE71
• Cytogenetics: 7q21.3
• Summary: 'This gene is similar to the oncomodulin gene, a high-affinity calcium ion-binding protein that belongs to the superfamily of calmodulin proteins, also known as the EF-hand proteins. [provided by RefSeq, Jul 2008]'