MECR (NM_016011) Human Mass Spec Standard

CAT#: PH324634

MECR MS Standard C13 and N15-labeled recombinant protein (NP_057095)

Product Images

Coomassie blue staining of purified MECR protein (Cat# TP324634). The protein was produced from HEK293T cells transfected with MECR cDNA clone (Cat# RC224634) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224634
• Predicted MW: 40.4 kDa
• Protein Sequence:
  Sequence Link

  >RC224634 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRG
  SDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRT
  EAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLR
  TINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGG
  TMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPL
  QDYQSALEASMKPFISSKQILTM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057095
• RefSeq Size: 2539
• RefSeq ORF: 1119
• Synonyms: CGI-63; DYTOABG; ETR1; FASN2B; NRBF1
• Locus ID: 51102
• UniProt ID: Q9BV79
• Cytogenetics: 1p35.3
• Summary: The protein encoded by this gene is an oxidoreductase that catalyzes the last step in mitochondrial fatty acid synthesis. Defects in this gene are a cause of childhood-onset dystonia and optic atrophy. [provided by RefSeq, Mar 2017]
• Protein Families: Druggable Genome
• Protein Pathways: Fatty acid elongation in mitochondria, Metabolic pathways