Apc6 (CDC16) (NM_001078645) Human Mass Spec Standard
CAT#: PH324869
CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_001072113)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224869 |
Predicted MW | 71.5 kDa |
Protein Sequence |
>RC224869 representing NM_001078645
Red=Cloning site Green=Tags(s) MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYE ACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIY DALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLK KYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNK ANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEH DQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHS LMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001072113 |
RefSeq Size | 2317 |
RefSeq ORF | 1860 |
Synonyms | ANAPC6; APC6; CDC16Hs; CUT9 |
Locus ID | 8881 |
UniProt ID | Q13042, A0A024RDZ2 |
Cytogenetics | 13q34 |
Summary | The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418359 | CDC16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421501 | CDC16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY418359 | Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1 |
USD 396.00 |
|
LY421501 | Transient overexpression lysate of cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2 |
USD 605.00 |
|
PH305639 | CDC16 MS Standard C13 and N15-labeled recombinant protein (NP_003894) |
USD 2,055.00 |
|
TP305639 | Recombinant protein of human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 1 |
USD 867.00 |
|
TP324869 | Recombinant protein of human cell division cycle 16 homolog (S. cerevisiae) (CDC16), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review