ICEBERG (CARD18) (NM_021571) Human Mass Spec Standard

CAT#: PH324896

CARD18 MS Standard C13 and N15-labeled recombinant protein (NP_067546)

Product Images

Coomassie blue staining of purified CARD18 protein (Cat# TP324896). The protein was produced from HEK293T cells transfected with CARD18 cDNA clone (Cat# RC224896) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224896
• Predicted MW: 10 kDa
• Protein Sequence:
  Sequence Link

  >RC224896 representing NM_021571
  Red=Cloning site Green=Tags(s)
  
  MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCC
  KFIKHLCEEDPQLASKMGLH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067546
• RefSeq Size: 431
• RefSeq ORF: 270
• Synonyms: ICEBERG; pseudo-ICE; UNQ5804
• Locus ID: 59082
• UniProt ID: P57730
• Cytogenetics: 11q22.3
• Protein Families: Druggable Genome
• Protein Pathways: NOD-like receptor signaling pathway