C7orf53 (LSMEM1) (NM_001134468) Human Mass Spec Standard
CAT#: PH325094
C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_001127940)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225094 |
Predicted MW | 14.3 kDa |
Protein Sequence |
>RC225094 representing NM_001134468
Red=Cloning site Green=Tags(s) MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIV LIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001127940 |
RefSeq ORF | 393 |
Synonyms | C7orf53 |
Locus ID | 286006 |
UniProt ID | Q8N8F7 |
Cytogenetics | 7q31.1 |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403647 | LSMEM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427449 | LSMEM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403647 | Transient overexpression lysate of chromosome 7 open reading frame 53 (C7orf53), transcript variant 1 |
USD 396.00 |
|
LY427449 | Transient overexpression lysate of chromosome 7 open reading frame 53 (C7orf53), transcript variant 2 |
USD 396.00 |
|
PH323802 | C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_872403) |
USD 2,055.00 |
|
TP323802 | Recombinant protein of human chromosome 7 open reading frame 53 (C7orf53), transcript variant 1 |
USD 748.00 |
|
TP325094 | Recombinant protein of human chromosome 7 open reading frame 53 (C7orf53), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review