CLDN19 (NM_001123395) Human Mass Spec Standard
CAT#: PH325251
CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_001116867)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225251 |
Predicted MW | 21.9 kDa |
Protein Sequence |
>RC225251 representing NM_001123395
Red=Cloning site Green=Tags(s) MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSL LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWY ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREY V myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001116867 |
RefSeq ORF | 633 |
Synonyms | HOMG5 |
Locus ID | 149461 |
UniProt ID | Q8N6F1 |
Cytogenetics | 1p34.2 |
Summary | The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407723 | CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426624 | CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY407723 | Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 1 |
USD 325.00 |
|
LY426624 | Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 2 |
USD 325.00 |
|
PH316887 | CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_683763) |
USD 2,055.00 |
|
TP316887 | Recombinant protein of human claudin 19 (CLDN19), transcript variant 1 |
USD 748.00 |
|
TP325251 | Recombinant protein of human claudin 19 (CLDN19), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review