TACC1 (NM_001122824) Human Mass Spec Standard

CAT#: PH325610

TACC1 MS Standard C13 and N15-labeled recombinant protein (NP_001116296)

Product Images

Coomassie blue staining of purified TACC1 protein (Cat# TP325610). The protein was produced from HEK293T cells transfected with TACC1 cDNA clone (Cat# RC225610) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225610
• Predicted MW: 43.8 kDa
• Protein Sequence:
  Sequence Link

  >RC225610 representing NM_001122824
  Red=Cloning site Green=Tags(s)
  
  MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFRSGCKVKKHETQSLALD
  ACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSS
  SEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIE
  ANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSD
  LFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESA
  ALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001116296
• RefSeq ORF: 1185
• Synonyms: Ga55
• Locus ID: 6867
• UniProt ID: O75410
• Cytogenetics: 8p11.22
• Summary: 'This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]'