RNF185 (NM_001135825) Human Mass Spec Standard

CAT#: PH326760

RNF185 MS Standard C13 and N15-labeled recombinant protein (NP_001129297)

Product Images

Coomassie blue staining of purified RNF185 protein (Cat# TP326760). The protein was produced from HEK293T cells transfected with RNF185 cDNA clone (Cat# RC226760) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC226760
• Predicted MW: 14 kDa
• Protein Sequence:
  Sequence Link

  >RC226760 representing NM_001135825
  Red=Cloning site Green=Tags(s)
  
  MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQGFQGF
  GFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129297
• RefSeq ORF: 408
• Synonyms: FLJ38628
• Locus ID: 91445
• UniProt ID: Q96GF1, A0A024R1H4
• Cytogenetics: 22q12.2
• Protein Families: Druggable Genome, Transmembrane