Nkx2.6 (NKX2-6) (NM_001136271) Human Mass Spec Standard
CAT#: PH326770
NKX2 MS Standard C13 and N15-labeled recombinant protein (NP_001129743)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226770 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC226770 representing NM_001136271
Red=Cloning site Green=Tags(s) MDAERMGEPQPGLNAASPLGGGTRVPERGVGNSGDSVRGGRSEQPKARQRRKPRVLFSQAQVLALERRFK QQRYLSAPEREHLASALQLTSTQVKIWFQNRRYKCKRQRQDKSLELAGHPLTPRRVAVPVLVRDGKPCLG PGPGAPAFPSPYSAAVSPYSCYGGYSGAPYGAGYGTCYAGAPSGPAPHTPLASAGFGHGGQNATPQGHLA ATLQGVRAW myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001129743 |
RefSeq ORF | 657 |
Synonyms | CSX2; CTHM; NKX2F; NKX4-2 |
Locus ID | 137814 |
UniProt ID | A6NCS4 |
Cytogenetics | 8p21.2 |
Summary | This gene encodes a homeobox-containing protein that belongs to the NK-2 homeobox family. This protein is a vertebrate homolog of Drosophila homeobox-containing protein called 'tinman', which has been shown to be essential for development of the heart-like dorsal vessel. In conjunction with related gene, NKX2-5, this gene may play a role in both pharyngeal and cardiac embryonic development. Mutations in this gene are associated with persistent truncus arteriosus. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427879 | NKX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY427879 | Transient overexpression lysate of NK2 transcription factor related, locus 6 (Drosophila) (NKX2-6) |
USD 396.00 |
|
TP326770 | Purified recombinant protein of Homo sapiens NK2 transcription factor related, locus 6 (Drosophila) (NKX2-6) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review