EDC3 (NM_001142443) Human Mass Spec Standard
CAT#: PH326857
EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135915)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226857 |
Predicted MW | 56.1 kDa |
Protein Sequence |
>RC226857 protein sequence
Red=Cloning site Green=Tags(s) MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGP GDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKS YVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNL ALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVP SISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQG ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVG INYHSPFGCKFVIPLHSA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001135915 |
RefSeq Size | 4086 |
RefSeq ORF | 1524 |
Synonyms | hYjeF_N2-15q23; LSM16; MRT50; YJDC; YJEFN2 |
Locus ID | 80153 |
UniProt ID | Q96F86 |
Cytogenetics | 15q24.1 |
Summary | This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability. [provided by RefSeq, May 2017] |
Protein Pathways | RNA degradation |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410908 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428097 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428098 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410908 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3 |
USD 396.00 |
|
LY428097 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 1 |
USD 396.00 |
|
LY428098 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 2 |
USD 396.00 |
|
PH302321 | EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_079359) |
USD 2,055.00 |
|
PH327114 | EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135916) |
USD 2,055.00 |
|
TP302321 | Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3 |
USD 823.00 |
|
TP326857 | Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 1 |
USD 748.00 |
|
TP327114 | Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review