PSD93 (DLG2) (NM_001142702) Human Mass Spec Standard
CAT#: PH326876
DLG2 MS Standard C13 and N15-labeled recombinant protein (NP_001136174)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226876 |
Predicted MW | 38.2 kDa |
Protein Sequence |
>RC226876 representing NM_001142702
Red=Cloning site Green=Tags(s) MMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEG DSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGDDGYGTKTLRGQEDLILSYEPVTRQE INYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIE AGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEMNKRLTEEQA KKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001136174 |
RefSeq ORF | 1002 |
Synonyms | chapsyn-110; PPP1R58; PSD-93; PSD93 |
Locus ID | 1740 |
UniProt ID | Q15700 |
Cytogenetics | 11q14.1 |
Summary | 'This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. The encoded protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described, but their full-length nature is not known. [provided by RefSeq, Dec 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428249 | DLG2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC428251 | DLG2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY428249 | Transient overexpression lysate of discs, large homolog 2 (Drosophila) (DLG2), transcript variant 1 |
USD 605.00 |
|
LY428251 | Transient overexpression lysate of discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4 |
USD 396.00 |
|
TP326876 | Recombinant protein of human discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4 |
USD 867.00 |
|
TP761236 | Purified recombinant protein of Human discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review