C17orf49 (NM_001142799) Human Mass Spec Standard

CAT#: PH326977

C17orf49 MS Standard C13 and N15-labeled recombinant protein (NP_001136271)

Product Images

Coomassie blue staining of purified C17orf49 protein (Cat# TP326977). The protein was produced from HEK293T cells transfected with C17orf49 cDNA clone (Cat# RC226977) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC226977
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC226977 representing NM_001142799
  Red=Cloning site Green=Tags(s)
  
  MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAQIKATVKRKVYEDSGIPLPAESPKKGPKKV
  ASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001136271
• RefSeq ORF: 414
• Synonyms: BAP18; HEPIS
• Locus ID: 124944
• UniProt ID: Q8IXM2
• Cytogenetics: 17p13.1
• Summary: Component of chromatin complexes such as the MLL1/MLL and NURF complexes. [UniProtKB/Swiss-Prot Function]