Kallikrein 11 (KLK11) (NM_001136032) Human Mass Spec Standard
CAT#: PH327537
KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_001129504)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227537 |
Predicted MW | 27.5 kDa |
Protein Sequence |
>RC227537 protein sequence
Red=Cloning site Green=Tags(s) MRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIV HLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGT SCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCN QSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001129504 |
RefSeq Size | 1195 |
RefSeq ORF | 750 |
Synonyms | PRSS20; TLSP |
Locus ID | 11012 |
UniProt ID | Q9UBX7, A0A1R3UDR5 |
Cytogenetics | 19q13.41 |
Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing and the use of alternate promoters results in multiple transcript variants encoding distinct isoforms which are differentially expressed. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408096 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416376 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427779 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430122 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432810 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408096 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
USD 396.00 |
|
LY416376 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 1 |
USD 396.00 |
|
LY427779 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 4 |
USD 396.00 |
|
LY430122 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
USD 396.00 |
|
LY432810 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 3 |
USD 396.00 |
|
PH306022 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_006844) |
USD 2,055.00 |
|
PH312547 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_659196) |
USD 2,055.00 |
|
TP306022 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 11 (KLK11), transcript variant 1 |
USD 439.00 |
|
TP312547 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
USD 823.00 |
|
TP327537 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr |
USD 748.00 |
|
TP720310 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review