NECAP2 (NM_001145277) Human Mass Spec Standard

CAT#: PH327659

NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138749)

Product Images

Coomassie blue staining of purified NECAP2 protein (Cat# TP327659). The protein was produced from HEK293T cells transfected with NECAP2 cDNA clone (Cat# RC227659) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227659
• Predicted MW: 29.3 kDa
• Protein Sequence:
  Sequence Link

  >RC227659 representing NM_001145277
  Red=Cloning site Green=Tags(s)
  
  MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQ
  APVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQ
  NPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVG
  GSLVQPAVAPSSDQLPARPSQAQAGSSSDLSTVFPHVTSGKALPHLGQRKEDEALLSWPVFGA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001138749
• RefSeq ORF: 819
• Synonyms: FLJ10420
• Locus ID: 55707
• UniProt ID: Q9NVZ3
• Cytogenetics: 1p36.13
• Summary: This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]