CCDC169 (NM_001144981) Human Mass Spec Standard

CAT#: PH327796

C13orf38 MS Standard C13 and N15-labeled recombinant protein (NP_001138453)

Product Images

Coomassie blue staining of purified CCDC169 protein (Cat# TP327796). The protein was produced from HEK293T cells transfected with CCDC169 cDNA clone (Cat# RC227796) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227796
• Predicted MW: 25.1 kDa
• Protein Sequence:
  Sequence Link

  >RC227796 representing NM_001144981
  Red=Cloning site Green=Tags(s)
  
  MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELND
  ELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAY
  QKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTGRYNPAKQKTVSAKRGPVKKITRPNHLP
  ELHP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001138453
• RefSeq ORF: 642
• Synonyms: C13orf38
• Locus ID: 728591
• UniProt ID: A6NNP5
• Cytogenetics: 13q13.3