UGT2B10 (NM_001144767) Human Mass Spec Standard

CAT#: PH327991

UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001138239)

Product Images

Coomassie blue staining of purified UGT2B10 protein (Cat# TP327991). The protein was produced from HEK293T cells transfected with UGT2B10 cDNA clone (Cat# RC227991) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227991
• Predicted MW: 50.5 kDa
• Protein Sequence:
  Sequence Link

  >RC227991 representing NM_001144767
  Red=Cloning site Green=Tags(s)
  
  MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSST
  LKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQ
  ESRFDIVFADAYLPCGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEF
  VQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGH
  PKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVIND
  PSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVL
  FIITKCCLFCFWKFARKGKKGKRD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001138239
• RefSeq ORF: 1332
• Synonyms: UDPGT2B10
• Locus ID: 7365
• UniProt ID: P36537
• Cytogenetics: 4q13.2
• Summary: ''
• Protein Families: Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism