Placenta growth factor / PGF Mouse Protein
Other products for "Pgf"
Specifications
Product Data | |
Species | Mouse |
Expression Host | Insect |
Expression cDNA Clone or AA Sequence |
ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNQTEEPHP
|
Predicted MW | ~ 40 kDa |
Purity | >95% by SDS-PAGE and silver stain |
Buffer | Presentation State: Purified State: Lyophilized protein Buffer System: 25 mM Tris, 75 mM NaCl pH 8.5 Stabilizer: BSA |
Bioactivity | Biological: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/ml. |
Endotoxin | < 0.1 ng per μg of PIGF |
Reconstitution | PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM Acetic Acid or PBS/water. This solution can be diluted into other buffered solutions. |
Preparation | Lyophilized protein |
Protein Description | Mouse recombinant Placenta Growth Factor, aa. 135 / 132 Result by N-terminal sequencing: ALSAGNNSTE and AGNNSTE |
Note | There are two equal forms, (i) Ala24 to Pro158 and (ii) Ala27 to Pro158. Protein RefSeq: NP_032853 mRNA RefSeq: NM_008827 |
Storage | Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_001258634 |
Locus ID | 18654 |
UniProt ID | Q544A5 |
Cytogenetics | 12 39.58 cM |
Synonyms | AI854365; PIGF; Plgf |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.