Placenta growth factor / PGF Mouse Protein

CAT#: AR26011PU-N

Placenta growth factor / PGF mouse recombinant protein, 5 µg


USD 260.00

2 Weeks*

Size
    • 5 ug

Product Images

Specifications

Product Data
Species Mouse
Expression Host Insect
Expression cDNA Clone or AA Sequence
ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNQTEEPHP
Predicted MW ~ kDa
Purity >95% by SDS-PAGE and silver stain
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: 25 mM Tris, 75 mM NaCl pH 8.5
Stabilizer: BSA
Bioactivity Biological: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/ml.
Endotoxin < 0.1 ng per μg of PIGF
Reconstitution PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM Acetic Acid or PBS/water. This solution can be diluted into other buffered solutions.
Preparation Lyophilized protein
Protein Description Mouse recombinant Placenta Growth Factor, aa. 135 / 132 
Result by N-terminal sequencing: ALSAGNNSTE and AGNNSTE
Note There are two equal forms, (i) Ala24 to Pro158 and (ii) Ala27 to Pro158.
Protein RefSeq: NP_032853
mRNA RefSeq: NM_008827
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_001258634
Locus ID 18654
UniProt ID Q544A5
Cytogenetics 12 39.58 cM
Synonyms AI854365; PIGF; Plgf

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.