Placenta growth factor / PGF Mouse Protein

CAT#: AR26011PU-S

Placenta growth factor / PGF mouse recombinant protein, 2 µg

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNQTEEPHP
• Predicted MW: ~ kDa
• Purity: >95% by SDS-PAGE and silver stain
• Buffer: Presentation State: Purified
  State: Lyophilized protein
  Buffer System: 25 mM Tris, 75 mM NaCl pH 8.5
  Stabilizer: BSA
• Bioactivity: Biological: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/ml.
• Endotoxin: < 0.1 ng per μg of PIGF
• Reconstitution: PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM Acetic Acid or PBS/water. This solution can be diluted into other buffered solutions.
• Preparation: Lyophilized protein
• Protein Description: Mouse recombinant Placenta Growth Factor, aa. 135 / 132
  Result by N-terminal sequencing: ALSAGNNSTE and AGNNSTE
• Note: There are two equal forms, (i) Ala24 to Pro158 and (ii) Ala27 to Pro158.
  Protein RefSeq: NP_032853
  mRNA RefSeq: NM_008827
• Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term.
  After reconstitution store the antibody undiluted at 2-8°C for one month
  or (in aliquots) at -20°C long term.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_001258634
• Locus ID: 18654
• UniProt ID: Q544A5
• Cytogenetics: 12 39.58 cM
• Synonyms: AI854365; PIGF; Plgf