FGF basic / FGF2 Rat Protein
Other products for "Fgf2"
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKGPGQKAILFLPMSAKS
Result by N-terminal sequencing: ALPEDGGGAFPP |
Predicted MW | 16.34 kDa |
Purity | >98% pure by SDS-PAGE |
Buffer | Presentation State: Purified State: Lyophilized freeze dried protein without additives. Buffer System: 0.5x PBS without stabilizers |
Bioactivity | Biological: The activity was determined by the stimulation of HUVE cells. The ED50 for this effect is ≤ 0.1ng/ml corresponding to a specific activity of ≥ 1 x 10e7 units/mg. |
Endotoxin | < 0.1ng per μg of Rat FGF-2 |
Reconstitution | Restore with ddH2O at 50 μg/ml. This solution can be diluted into other buffered solutions or stored frozen for future use. |
Preparation | Lyophilized freeze dried protein without additives. |
Protein Description | Recombinant Rat Fibroblast Growth Factor-2. The cDNA of native rat FGF-2 (Ala11-Ser154) was cloned from total RNA derived from a rat embryo using standard protocols. |
Storage | The lyophilized Rat FGF-2, though stable at room temperature, is best stored in working aliquots at –20°C to –70°C. Avoid repeated freeze-thaw cycles! |
Stability | Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062178 |
Locus ID | 54250 |
UniProt ID | P13109 |
Cytogenetics | 2q25 |
Synonyms | bFGF; Fgf-2 |
Summary | activates the MAP kinase signaling pathway; plays a role in synaptic transmission; induces cell proliferation [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.