FGF basic / FGF2 Rat Protein

CAT#: AR31055PU-N

FGF basic / FGF2 rat recombinant protein, 10 µg

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKGPGQKAILFLPMSAKS
  Result by N-terminal sequencing: ALPEDGGGAFPP
• Predicted MW: 16.34 kDa
• Purity: >98% pure by SDS-PAGE
• Buffer: Presentation State: Purified
  State: Lyophilized freeze dried protein without additives.
  Buffer System: 0.5x PBS without stabilizers
• Bioactivity: Biological: The activity was determined by the stimulation of HUVE cells. The ED50 for this effect is ≤ 0.1ng/ml corresponding to a specific activity of ≥ 1 x 10e7 units/mg.
• Endotoxin: < 0.1ng per μg of Rat FGF-2
• Reconstitution: Restore with ddH2O at 50 μg/ml.
  This solution can be diluted into other buffered solutions or stored frozen for future use.
• Preparation: Lyophilized freeze dried protein without additives.
• Protein Description: Recombinant Rat Fibroblast Growth Factor-2. The cDNA of native rat FGF-2 (Ala11-Ser154) was cloned from total RNA derived from a rat embryo using standard protocols.
• Storage: The lyophilized Rat FGF-2, though stable at room temperature, is best stored in working aliquots at –20°C to –70°C.
  Avoid repeated freeze-thaw cycles!
• Stability: Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062178
• Locus ID: 54250
• UniProt ID: P13109
• Cytogenetics: 2q25
• Synonyms: bFGF; Fgf-2
• Summary: activates the MAP kinase signaling pathway; plays a role in synaptic transmission; induces cell proliferation [RGD, Feb 2006]