Placenta growth factor / PGF Rat Protein

CAT#: AR31058PU-S

Placenta growth factor / PGF rat recombinant protein, 2 µg


USD 190.00

2 Weeks*

Size
    • 2 ug

Product Images

Specifications

Product Data
Species Rat
Expression Host Insect
Expression cDNA Clone or AA Sequence
ALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTQTEEPHL
Result by N-terminal sequencing: ALSAGNNSTEMEV
Predicted MW 15.14 kDa
Purity >95% by SDS-PAGE and Silver stain
Buffer Presentation State: Purified
State: Lyophilized freeze dried protein without additives.
Bioactivity Biological: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant rat PlGF can bind to immobilized rh-sFlt-1 (100ng/well) with a linear range at 0.1-5ng/ml.
Endotoxin < 0.1ng per µg of Rat PlGF
Reconstitution Restore with water. This solution can be diluted into other buffered solutions or stored frozen for future use.
Preparation Lyophilized freeze dried protein without additives.
Protein Description Recombinant Rat Placenta Growth Factor. The full ORF of rat PlGF (Met1-Leu158) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols. The native protein expressed in insect cells starts with Ala24.
Storage The lyophilized Rat PIGF, though stable at room temperature, is best stored in working aliquots at –20°C to –70°C.
Avoid repeated freeze-thaw cycles!
Stability Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_446047
Locus ID 94203
UniProt ID Q63434
Cytogenetics 6q31
Synonyms Plgf
Summary forms a heterodimer with VEGF; may play a role in vascular endothelial cell proliferation [RGD, Feb 2006]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.