Placenta growth factor / PGF Rat Protein

CAT#: AR31058PU-S

Placenta growth factor / PGF rat recombinant protein, 2 µg

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  ALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTQTEEPHL
  Result by N-terminal sequencing: ALSAGNNSTEMEV
• Predicted MW: 15.14 kDa
• Purity: >95% by SDS-PAGE and Silver stain
• Buffer: Presentation State: Purified
  State: Lyophilized freeze dried protein without additives.
• Bioactivity: Biological: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant rat PlGF can bind to immobilized rh-sFlt-1 (100ng/well) with a linear range at 0.1-5ng/ml.
• Endotoxin: < 0.1ng per µg of Rat PlGF
• Reconstitution: Restore with water. This solution can be diluted into other buffered solutions or stored frozen for future use.
• Preparation: Lyophilized freeze dried protein without additives.
• Protein Description: Recombinant Rat Placenta Growth Factor. The full ORF of rat PlGF (Met1-Leu158) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols. The native protein expressed in insect cells starts with Ala24.
• Storage: The lyophilized Rat PIGF, though stable at room temperature, is best stored in working aliquots at –20°C to –70°C.
  Avoid repeated freeze-thaw cycles!
• Stability: Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_446047
• Locus ID: 94203
• UniProt ID: Q63434
• Cytogenetics: 6q31
• Synonyms: Plgf
• Summary: forms a heterodimer with VEGF; may play a role in vascular endothelial cell proliferation [RGD, Feb 2006]