CD202b / TEK (C-term, His-tag) Mouse Protein

CAT#: AR31062PU-L

CD202b / TEK (C-term, His-tag) mouse recombinant protein, 50 µg

Specifications

Product Data

• Species: Mouse
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  AMDLILINSLPLVSDAETLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYCEGRVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNVNISFKKVLIKEEAVIYKNGSIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCRPCTTCKNNGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCPPYGCSCATGWRGLQCNEACPSGYYGPDCKLRCHCTNEEICDRFQGCLCSQGWQGLQCKEGRPRMTPQIEDLPDHIEVNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNYDRFSVAIFTVNVLPPDSGVWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFIINISSEPYFGDGPIKSKKLFYKPVNQAWKYIEVTNEIFTLNYLEPRTDY
  ELCVQLARPEGGEGHPGPVRRFTTASIGLPPPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSQTTSDQQNIKVPGNLTSVLLSNLVPREQYTVRARVNTKAQGEWSEELRAWTLSDILPPQNIKISNITDSTAMVSWTIVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGEPETTYHVDIFAENNIGSSNPAFSHELRTLPHSPASATRHHHHHH
• Tag: His-tag
• Predicted MW: 95 kDa
• Purity: >95%
• Buffer: Presentation State: Purified
  State: Lyophilized purified protein.
  Buffer System: PBS without stabilizer
• Bioactivity: Biological: Measured in a functional ELISA assay.
  When TIE-2 is immobilized at 4 μg/mL (100 μl/well), it binds recombinant human Angiopoietin-2 with a linear range of 2-100 ng/ml.
• Endotoxin: < 0.1ng per μg sTIE-2
• Reconstitution: The lyophilised sTIE-2 is soluble in water and most aqueous buffers.
  The lyophilised sTIE-2 should be restored in PBS or medium to a concentration not lower than 50 μg/ml.
• Preparation: Lyophilized purified protein.
• Protein Description: Recombinant Mouse soluble TIE-2 was fused with a 6x His-tag at the C-terminus.
• Storage: Samples are stable for 2-4 weeks at 2-8°C.
  sTIE-1 should be stored in working aliquots at -20°C to -80°C.
  Avoid repeated freeze-thaw cycles!
• Stability: Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001277478
• Locus ID: 21687
• UniProt ID: Q02858
• Cytogenetics: 4 43.34 cM
• Synonyms: AA517024; Cd202b; Hyk; STK1; Tie-2; Tie2