CD202b / TEK (C-term, His-tag) Human Protein

CAT#: AR31063PU-L

CD202b / TEK (C-term, His-tag) human recombinant protein, 50 µg

Specifications

Product Data

• Species: Human
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGD GPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATIIQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHEVTLPESQAPADLGGGKTRHHHHHH
• Tag: His-tag
• Predicted MW: 95 kDa
• Purity: >90%
• Buffer: Presentation State: Purified
  State: Lyophilized purified protein.
  Buffer System: PBS without stabilizer
• Bioactivity: Biological: Measured in a functional ELISA assay. When TIE-2-His is immobilized at 4μg/ml (100 μl/well), it binds recombinant human Angiopoietin-2 with a linear range of 2-100 ng/ml.
• Endotoxin: < 0.1ng per μg sTIE-2-His
• Reconstitution: The lyophilized sTIE-2-His is soluble in water and most aqueous buffers and should be restored in PBS or medium to a concentration not lower than 50 μg/ml.
• Preparation: Lyophilized purified protein.
• Protein Description: Recombinant Human soluble TIE-2/TEK was fused with a 6x His-tag at the C-terminus. The soluble receptor protein consists of the full extracellular domain (Thr19-Lys745).
• Storage: Lyophilized samples are stable for greater than six months at –20°C to –70°C.
  Reconstituted sTIE-2-His should be stored in working aliquots at -20°C.
  Avoid repeated freeze-thaw cycles!
• Stability: Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000450
• Locus ID: 7010
• UniProt ID: Q02763, Q59HG2
• Cytogenetics: 9p21.2
• Synonyms: CD202B; GLC3E; TIE-2; TIE2; VMCM; VMCM1
• Summary: 'This gene encodes a receptor that belongs to the protein tyrosine kinase Tie2 family. The encoded protein possesses a unique extracellular region that contains two immunoglobulin-like domains, three epidermal growth factor (EGF)-like domains and three fibronectin type III repeats. The ligand angiopoietin-1 binds to this receptor and mediates a signaling pathway that functions in embryonic vascular development. Mutations in this gene are associated with inherited venous malformations of the skin and mucous membranes. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane