CD202b / TEK (C-term, His-tag) Human Protein

CAT#: AR31063PU-N

CD202b / TEK (C-term, His-tag) human recombinant protein, 10 µg


USD 200.00

2 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Species Human
Expression Host Insect
Expression cDNA Clone or AA Sequence
AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGD GPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATIIQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHEVTLPESQAPADLGGGKTRHHHHHH
Tag His-tag
Predicted MW 95 kDa
Purity >90%
Buffer Presentation State: Purified
State: Lyophilized purified protein.
Buffer System: PBS without stabilizer
Bioactivity Biological: Measured in a functional ELISA assay. When TIE-2-His is immobilized at 4μg/ml (100 μl/well), it binds recombinant human Angiopoietin-2 with a linear range of 2-100 ng/ml.
Endotoxin < 0.1ng per μg sTIE-2-His
Reconstitution The lyophilized sTIE-2-His is soluble in water and most aqueous buffers and should be restored in PBS or medium to a concentration not lower than 50 μg/ml.
Preparation Lyophilized purified protein.
Protein Description Recombinant Human soluble TIE-2/TEK was fused with a 6x His-tag at the C-terminus. The soluble receptor protein consists of the full extracellular domain (Thr19-Lys745).
Storage Lyophilized samples are stable for greater than six months at –20°C to –70°C.
Reconstituted sTIE-2-His should be stored in working aliquots at -20°C.
Avoid repeated freeze-thaw cycles!
Stability Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_000450
Locus ID 7010
UniProt ID Q02763, Q59HG2
Cytogenetics 9p21.2
Synonyms CD202B; GLC3E; TIE-2; TIE2; VMCM; VMCM1
Summary 'This gene encodes a receptor that belongs to the protein tyrosine kinase Tie2 family. The encoded protein possesses a unique extracellular region that contains two immunoglobulin-like domains, three epidermal growth factor (EGF)-like domains and three fibronectin type III repeats. The ligand angiopoietin-1 binds to this receptor and mediates a signaling pathway that functions in embryonic vascular development. Mutations in this gene are associated with inherited venous malformations of the skin and mucous membranes. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]'
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.