ESM1 (His-tag) Human Protein

CAT#: AR60002PU-N

ESM1 (His-tag) human recombinant protein, 50 µg

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRTRHHHHHH
• Tag: His-tag
• Predicted MW: 21.17 kDa
• Purity: >95% by SDS-PAGE and Silver staining
• Buffer: Presentation State: Purified
  State: Lyophilized protein
  Buffer System: 50 mM NaP, 300 mM NaCl, pH 8.0
  Stabilizer: None
• Reconstitution: Restore in water to a concentration of 0.1 mg/ml.
• Preparation: Lyophilized protein
• Protein Description: Recombinant human Endocan / ESM1.
  Result by N-terminal sequencing: WSNNYAVD
• Note: mRNA RefSeq: NM_007036.4
• Storage:

  Prior to reconstitution store at 2-8°C.
  Following reconstitution store undiluted at 2-8°C for one month
  or (in aliquots) at -20°C for longer.
  Avoid repeated freezing and thawing.

• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_001129076
• Locus ID: 11082
• UniProt ID: Q9NQ30
• Cytogenetics: 5q11.2
• Synonyms: endocan
• Summary: This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome, Secreted Protein