ESM1 (His-tag) Mouse Protein
Other products for "Esm1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | Insect |
Expression cDNA Clone or AA Sequence |
WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRTRHHHHHH
|
Tag | His-tag |
Predicted MW | 19.07 kDa |
Purity | >95% by SDS-PAGE and Silver staining |
Buffer | Presentation State: Purified State: Lyophilized protein Buffer System: H2O Stabilizer: None |
Reconstitution | Restore in water to a concentration of 0.1 mg/ml. |
Preparation | Lyophilized protein |
Protein Description | Recombinant mouse Endocan / ESM1 Result by N-terminal sequencing: WSAKYAVD |
Note | mRNA RefSeq: NM_023612.3 |
Storage | Prior to reconstitution store at 2-8°C. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_076101 |
Locus ID | 71690 |
UniProt ID | Q9QYY7, B9EJX9 |
Cytogenetics | 13 D2.2 |
Synonyms | 0610042H23Rik; AV004503; ESM-1 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.