ESM1 (His-tag) Mouse Protein

CAT#: AR60003PU-N

ESM1 (His-tag) mouse recombinant protein, 50 µg


USD 365.00

2 Weeks*

Size
    • 50 ug

Product Images

Other products for "Esm1"

Specifications

Product Data
Species Mouse
Expression Host Insect
Expression cDNA Clone or AA Sequence
WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRTRHHHHHH
Tag His-tag
Predicted MW 19.07 kDa
Purity >95% by SDS-PAGE and Silver staining
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: H2O
Stabilizer: None
Reconstitution Restore in water to a concentration of 0.1 mg/ml.
Preparation Lyophilized protein
Protein Description Recombinant mouse Endocan / ESM1
Result by N-terminal sequencing: WSAKYAVD
Note mRNA RefSeq: NM_023612.3
Storage

Prior to reconstitution store at 2-8°C.
Following reconstitution store undiluted at 2-8°C for one month
or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.

Stability Shelf life: one year from despatch.

Reference Data
RefSeq NP_076101
Locus ID 71690
UniProt ID Q9QYY7, B9EJX9
Cytogenetics 13 D2.2
Synonyms 0610042H23Rik; AV004503; ESM-1

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.