PRAME / MAPE Human Protein
Other products for "PRAME"
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
|
Predicted MW | 10.7 kDa |
Purity | >98% by SDS-PAGE and Silver staining |
Buffer | Presentation State: Purified State: Lyophilized protein Buffer System: 10mM Tris, 25 mM NaP, pH 7.4 Stabilizer: None |
Reconstitution | Restore in water to a concentration of 0.1 mg/ml. |
Preparation | Lyophilized protein |
Applications | Positive control for Western blot analysis. Standard for ELISA. |
Protein Description | Recombinant human PRAME fragment corresponding to amino acid sequence Met321 to Ile420. |
Note | mRNA RefSeq: NM_006115.3 |
Storage | Prior to reconstitution store desiccated at 2-8°C. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_001278644 |
Locus ID | 23532 |
UniProt ID | P78395, A0A024R1E6 |
Cytogenetics | 22q11.22 |
Synonyms | CT130; MAPE; OIP-4; OIP4 |
Summary | This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.