PRAME / MAPE Human Protein

CAT#: AR60005PU-N

PRAME / MAPE human recombinant protein, 20 µg

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
• Predicted MW: 10.7 kDa
• Purity: >98% by SDS-PAGE and Silver staining
• Buffer: Presentation State: Purified
  State: Lyophilized protein
  Buffer System: 10mM Tris, 25 mM NaP, pH 7.4
  Stabilizer: None
• Reconstitution: Restore in water to a concentration of 0.1 mg/ml.
• Preparation: Lyophilized protein
• Applications: Positive control for Western blot analysis.
  Standard for ELISA.
• Protein Description: Recombinant human PRAME fragment corresponding to amino acid sequence Met321 to Ile420.
  
  
• Note: mRNA RefSeq: NM_006115.3
• Storage:

  Prior to reconstitution store desiccated at 2-8°C.
  Following reconstitution store undiluted at 2-8°C for one month
  or (in aliquots) at -20°C for longer.
  Avoid repeated freezing and thawing.

• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_001278644
• Locus ID: 23532
• UniProt ID: P78395, A0A024R1E6
• Cytogenetics: 22q11.22
• Synonyms: CT130; MAPE; OIP-4; OIP4
• Summary: This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]