EGFL7 (His-tag) Human Protein

CAT#: AR60007PU-N

EGFL7 (His-tag) human recombinant protein, 20 µg

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  HHHHHHTEHAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
• Tag: His-tag
• Predicted MW: 22.75 kDa
• Purity: >95% by SDS-PAGE and Silver staining
• Buffer: Presentation State: Purified
  State: Lyophilized protein
  Buffer System: H2O
  Stabilizer: None
• Reconstitution: Restore in water to a concentration not lower than 50µg/ml.
  For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
• Preparation: Lyophilized protein
• Applications: Positive control for Western blot analysis
• Protein Description: Recombinant human EGFL7 with N-terminal His-tag
• Note: mRNA RefSeq: NM 016215.4
• Storage: Prior to reconstitution store at 2-8°C.
  Following reconstitution store undiluted at 2-8°C for one month
  or (in aliquots) at -20°C for longer.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_057299
• Locus ID: 51162
• UniProt ID: Q9UHF1, A0A024R8F5
• Cytogenetics: 9q34.3
• Synonyms: NEU1; VE-STATIN; ZNEU1
• Summary: This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]
• Protein Families: Secreted Protein