EGFL7 (His-tag) Human Protein

CAT#: AR60007PU-N

EGFL7 (His-tag) human recombinant protein, 20 µg


USD 210.00

2 Weeks*

Size
    • 20 ug

Product Images

Other products for "EGFL7"

Specifications

Product Data
Species Human
Expression Host Insect
Expression cDNA Clone or AA Sequence
HHHHHHTEHAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Tag His-tag
Predicted MW 22.75 kDa
Purity >95% by SDS-PAGE and Silver staining
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: H2O
Stabilizer: None
Reconstitution Restore in water to a concentration not lower than 50µg/ml.
For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Preparation Lyophilized protein
Applications Positive control for Western blot analysis
Protein Description Recombinant human EGFL7 with N-terminal His-tag
Note mRNA RefSeq: NM 016215.4
Storage Prior to reconstitution store at 2-8°C.
Following reconstitution store undiluted at 2-8°C for one month 
or (in aliquots) at -20°C for longer. 
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_057299
Locus ID 51162
UniProt ID Q9UHF1, A0A024R8F5
Cytogenetics 9q34.3
Synonyms NEU1; VE-STATIN; ZNEU1
Summary This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]
Protein Families Secreted Protein

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.