Placenta growth factor / PGF (Isoform PlGF-2) Human Protein

CAT#: DA3510

Placenta growth factor / PGF (Isoform PlGF-2) human recombinant protein, 5 µg

Specifications

Product Data

• Species: Human
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
• Predicted MW: ~ 45 kDa
• Purity: >90% pure by SDS-PAGE and visualised by silver stain.
• Buffer: Presentation State: Purified
  State: Lyophilized purified protein.
  Buffer System: 50 mM Acetic Acid with BSA (50-fold) as stabilizer.
• Bioactivity: Biological: Measured by its ability to bind to immobilized recombinant Human sFlt-1 in a functional ELISA.
  Recombinant human PlGF-2 can bind to immobilized rh sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/ml.
• Endotoxin: 0.1 ng per µg of PIGF-2
• Reconstitution: Restore with 50 mM Acetic Acid or PBS/Water. Centrifuge vial before opening!
• Preparation: Lyophilized purified protein.
• Protein Description: Recombinant Human Placenta Growth Factor-2 / PIGF-2.
  Result by N-terminal sequencing: LPAVPPQQWA
  Length (aa): 152
• Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term.
  After reconstitution store the antibody undiluted at 2-8°C for one month
  or (in aliquots) at -20°C long term.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_001193941
• Locus ID: 5228
• UniProt ID: P49763, Q86TW6
• Cytogenetics: 14q24.3
• Synonyms: D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760
• Summary: 'This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma