Placenta growth factor / PGF (Isoform PlGF-2) Human Protein

CAT#: DA3510X

Placenta growth factor / PGF (Isoform PlGF-2) human recombinant protein, 20 µg


USD 190.00

2 Weeks*

Size
    • 2 ug

Product Images

Specifications

Product Data
Species Human
Expression Host Insect
Expression cDNA Clone or AA Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Predicted MW ~ 45 kDa
Purity >80% pure by SDS-PAGE and visualised by silver stain.
Buffer Presentation State: Purified
State: Lyophilized purified protein.
Buffer System: 50 mM Acetic Acid with BSA (50-fold) as stabilizer.
Bioactivity Biological: Measured by its ability to bind to immobilized recombinant Human sFlt-1 in a functional ELISA.
Recombinant human PlGF-2 can bind to immobilized rh sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/ml.
Endotoxin 0.1 ng per µg of PIGF-2
Reconstitution Restore with 50 mM Acetic Acid or PBS/Water. Centrifuge vial before opening!
Preparation Lyophilized purified protein.
Protein Description Recombinant Human Placenta Growth Factor-2 / PIGF-2. 
Result by N-terminal sequencing: LPAVPPQQWA 
Length (aa): 152
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_001193941
Locus ID 5228
UniProt ID P49763, Q86TW6
Cytogenetics 14q24.3
Synonyms D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760
Summary 'This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]'
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.