KITLG / SCF Human Protein

CAT#: DA3511

KITLG / SCF human recombinant protein, 2 µg


USD 505.00

2 Weeks*

Size
    • 20 ug

Product Images

Specifications

Product Data
Species Human
Expression Host Insect
Expression cDNA Clone or AA Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Predicted MW ~ 45 kDa
Purity >95% 95% by SDS-PAGE and visualised by silver stain
Buffer Presentation State: Purified
State: Lyophilized purified protein
Buffer System: PBS, pH 7.4, without stabilizer
Bioactivity Biological: Measured in a cell proliferation assay using TF 1 human erythroleukemic cells [Kitamura T et al, J Cell Physiol, 1989]. The ED50 for this effect is typically 1‑5 ng/ml.
Endotoxin < 0.1 ng per µg of SCF
Reconstitution Restore in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Preparation Lyophilized purified protein
Protein Description Recombinant Human Stem Cell Factor (SCF) His-tag.
Soluble Stem Cell Factor (SCF), a 18.4kDa protein consisting of 165 amino acid residues (Glu26-Ala190) and fused to a C-terminal His-tag (6x His).
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_001193941
Locus ID 5228
UniProt ID P49763, Q86TW6
Cytogenetics 14q24.3
Synonyms D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760
Summary 'This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]'
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.