KITLG / SCF Human Protein

CAT#: DA3511

KITLG / SCF human recombinant protein, 2 µg

Specifications

Product Data

• Species: Human
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
• Predicted MW: ~ 45 kDa
• Purity: >95% 95% by SDS-PAGE and visualised by silver stain
• Buffer: Presentation State: Purified
  State: Lyophilized purified protein
  Buffer System: PBS, pH 7.4, without stabilizer
• Bioactivity: Biological: Measured in a cell proliferation assay using TF 1 human erythroleukemic cells [Kitamura T et al, J Cell Physiol, 1989]. The ED50 for this effect is typically 1‑5 ng/ml.
• Endotoxin: < 0.1 ng per µg of SCF
• Reconstitution: Restore in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
• Preparation: Lyophilized purified protein
• Protein Description: Recombinant Human Stem Cell Factor (SCF) His-tag.
  Soluble Stem Cell Factor (SCF), a 18.4kDa protein consisting of 165 amino acid residues (Glu26-Ala190) and fused to a C-terminal His-tag (6x His).
• Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term.
  After reconstitution store the antibody undiluted at 2-8°C for one month
  or (in aliquots) at -20°C long term.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_001193941
• Locus ID: 5228
• UniProt ID: P49763, Q86TW6
• Cytogenetics: 14q24.3
• Synonyms: D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760
• Summary: 'This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma