KITLG / SCF Human Protein
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Other products for "PGF"
Specifications
Product Data | |
Species | Human |
Expression Host | Insect |
Expression cDNA Clone or AA Sequence |
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
|
Predicted MW | ~ 45 kDa |
Purity | >95% 95% by SDS-PAGE and visualised by silver stain |
Buffer | Presentation State: Purified State: Lyophilized purified protein Buffer System: PBS, pH 7.4, without stabilizer |
Bioactivity | Biological: Measured in a cell proliferation assay using TF 1 human erythroleukemic cells [Kitamura T et al, J Cell Physiol, 1989]. The ED50 for this effect is typically 1‑5 ng/ml. |
Endotoxin | < 0.1 ng per µg of SCF |
Reconstitution | Restore in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C. |
Preparation | Lyophilized purified protein |
Protein Description | Recombinant Human Stem Cell Factor (SCF) His-tag. Soluble Stem Cell Factor (SCF), a 18.4kDa protein consisting of 165 amino acid residues (Glu26-Ala190) and fused to a C-terminal His-tag (6x His). |
Storage | Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_001193941 |
Locus ID | 5228 |
UniProt ID | P49763, Q86TW6 |
Cytogenetics | 14q24.3 |
Synonyms | D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760 |
Summary | 'This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.