CD105 / Endoglin Mouse Protein

CAT#: DA3522X

CD105 / Endoglin mouse recombinant protein, 25 µg


USD 340.00

2 Weeks*

Size
    • 25 ug

Product Images

Specifications

Product Data
Species Mouse
Expression Host Insect
Expression cDNA Clone or AA Sequence
ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH
Predicted MW 70-75 kDa
Purity >90% by SDS-PAGE and visualized by Silver stain
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: PBS
Stabilizer: None
Endotoxin < 0.1 ng per µg of sCD105.
Reconstitution The lyophilized sCD105 is soluble in water and most aqueous buffers. Restore in PBS or medium to a concentration not lower than 50 μg/ml.
Preparation Lyophilized protein
Protein Description Recombinant Mouse Soluble CD105/Endoglin.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_001139820
Locus ID 13805
UniProt ID Q3UAM9
Cytogenetics 2 22.09 cM
Synonyms AI528660; AI662476; CD105; Endo; S-endoglin

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.