CD105 / Endoglin Mouse Protein
Other products for "Eng"
Specifications
Product Data | |
Species | Mouse |
Expression Host | Insect |
Expression cDNA Clone or AA Sequence |
ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH
|
Predicted MW | 70-75 kDa |
Purity | >90% by SDS-PAGE and visualized by Silver stain |
Buffer | Presentation State: Purified State: Lyophilized protein Buffer System: PBS Stabilizer: None |
Endotoxin | < 0.1 ng per µg of sCD105. |
Reconstitution | The lyophilized sCD105 is soluble in water and most aqueous buffers. Restore in PBS or medium to a concentration not lower than 50 μg/ml. |
Preparation | Lyophilized protein |
Protein Description | Recombinant Mouse Soluble CD105/Endoglin. |
Storage | Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_001139820 |
Locus ID | 13805 |
UniProt ID | Q3UAM9 |
Cytogenetics | 2 22.09 cM |
Synonyms | AI528660; AI662476; CD105; Endo; S-endoglin |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.