LYVE-1 Mouse Protein

CAT#: DA3524

LYVE-1 mouse recombinant protein, 20 µg

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
• Predicted MW: 45 kDa
• Purity: >95% by SDS-PAGE and visualised by silver stain
• Buffer: Presentation State: Purified
  State: Lyophilized protein
  Buffer System: PBS
  Stabilizer: None
• Endotoxin: < 0.1 ng per µg of VEGF-C
• Reconstitution: Lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilised sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
• Preparation: Lyophilized protein
• Protein Description: Recombinant Mouse Soluble LYVE-1-His.
  A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 - Gly228) was fused to a C-terminal His -tag (6xHis) and expressed in insect cells.
  Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24.
  Result by N-terminal sequencing: ADLVQDLS
  Length: 211 amino acids.
• Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term.
  After reconstitution store the antibody undiluted at 2-8°C for one month
  or (in aliquots) at -20°C long term.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_444477
• Locus ID: 114332
• UniProt ID: Q8BHC0
• Cytogenetics: 7 E3
• Synonyms: 1200012G08Rik; Crsbp-1; Lyve-1; Xlkd1