LYVE-1 Mouse Protein

CAT#: DA3524

LYVE-1 mouse recombinant protein, 20 µg


USD 210.00

2 Weeks*

Size
    • 20 ug

Product Images

Other products for "Lyve1"

Specifications

Product Data
Species Mouse
Expression Host Insect
Expression cDNA Clone or AA Sequence
ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
Predicted MW 45 kDa
Purity >95% by SDS-PAGE and visualised by silver stain
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: PBS
Stabilizer: None
Endotoxin < 0.1 ng per µg of VEGF-C
Reconstitution Lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilised sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
Preparation Lyophilized protein
Protein Description Recombinant Mouse Soluble LYVE-1-His.
A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 - Gly228) was fused to a C-terminal His -tag (6xHis) and expressed in insect cells.
Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24. 
Result by N-terminal sequencing: ADLVQDLS 
Length: 211 amino acids.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_444477
Locus ID 114332
UniProt ID Q8BHC0
Cytogenetics 7 E3
Synonyms 1200012G08Rik; Crsbp-1; Lyve-1; Xlkd1

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.